Loading...
WS-12-513Inspection Worksheet Miami Shores Village 10050 N.E. 2nd Avenue Miami Shores, FL Phone: (305)795 -2204 Fax: (305)756 -8972 Inspection Number: INSP- 175158 Permit Number: WS -3 -12 -513 Scheduled Inspection Date: June 28, 2012 Inspector: Bruhn, Norman Owner: AWONSA, FATAAB JIMMY Job Address: 325 NW 111 Street Miami Shores, FL 33168 -3303 Project: <NONE> Contractor: EZ HOME IMPROVEMENTS INC Permit Type: Windows /Shutters Inspection Type: Shutter Final Work Classification: Shutters Phone Number Parcel Number 1121360010750 Building Department Comments HURRICANE ACCORDION SHUTTER 11 OPENINGS Pass (, � 6Z Failed Correction Needed Re- Inspection Fee No Additional Inspections can be scheduled until re- inspection fee is paid. Inspector Comments CREATED AS REINSPECTION FOR INSP- 171527. Permit and plan smust be accessible. Panels must be installed. NB June 27, 2012 For Inspections please call: (305)762 -4949 Page 15 of 24 CSI B I DING PERMIT APPLICATION FBC 20 1" Permit Type BUILDI G ROOFING Miami Shores Village Building Department 10050 N.E.2nd Avenue, Miami Shores, Florida 33138 Tel: (305) 795.2204 Fax: (305) 756.8972 INSPECTION'S PHONE NUMBER: (305) 762.4949 Permit No. LU S 12,''St� Master Permit No. OWNER: Name (Fee Simple Titleholder): FGt+ taro J • Nwovna Phone #: 326 Nkl 111 She. 1- Address: City: 1,-11 I Gt.v I State: ft. Zip: 331 6? - 3303 Tenant/Lessee Name: Phone #: Email: JOB ADDRESS: 325 ■11.0 III S 1d4 City: Miami Shores County: Folio/Parcel #: I I - 2I3to 001- 0? 513 Miami Dade Zip: 33 I Co 8- 3303 Is the Building Historically Designated: Yes NO Flood Zone: ( r 1'') CONTRACTOR: Company Name: E _ in -owe 2Y�1 -r1 Phone #: �J�� " V �1 Address: 1WDS SIA) 11)4- Mello-e. # IS City: M l tt l 1 yy -- State: 1Z Zip: 33 I Si Qualifier Name: elYne,r �tVfl VYI €. -t'1 r1 Phone #: State Certification or Registration #: C2.G057 6 t4 LP Certificate of Competency #: C.{QC 0S7 bi-( to Contact Phone #: 305• oZ 35 - a S10 2 Email Address: . ed ImQ,t 11 c v 4AI- DESIGNER: Architect/Engineer: Phone #: Value of Work for this Permit: $ 512 . OD Square/Linear Footage of Work: Type of Work: Addition L OAlteration R ONew C URepair/Replace Description of Work: 1 GA 2. t' �"GG.drl�c..17Y1 c�IAA-t 4 y 1 ‘ ODemolition ******** ***** * ** ****** * * *** *** * * * ****** Fees************* * **** ********* * ***** *** ******** Submittal Fee $). L ' Permit Fee $ 0 / 0°' CCF $ CO /CC $ Scanning Fee $ Radon Fee $ DBPR $ Bond $ Notary $ Training/Education Fee $ Technology Fee $ Double Fee $ Structural Review $ TOTAL FEE NOW DUE $ Pont>:,g Company's Name (if applicable) Bonding Company's Address City State Zip Mortgage Lender's Name (if applicable) Mortgage Lender's Address City State Zip Application is hereby made to obtain a permit to do the work and installations as indicated. I certify that no work or installation has commenced prior to the issuance of a permit and that all work will be performed to meet the standards of all laws regulating construction in this jurisdiction. I understand that a separate permit must be secured for ELECTRICAL WORK, PLUMBING, SIGNS, WELLS, POOLS, FURNACES, BOILERS, HEATERS, TANKS and AIR CONDITIONERS, ETC OWNER'S AFFIDAVIT: I certify that all the foregoing information is accurate and that all work will be done in compliance with all applicable laws regulating construction and zoning. "WARNING TO OWNER: YOUR FAILURE TO RECORD A NOTICE OF COMMENCEMENT MAY RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE RECORDING YOUR NOTICE OF COMMENCEMENT." Notice to Applicant: As a condition to the issuance of a building permit with an estimated value exceeding $2500, the applicant must promise in good faith that a copy of the notice of commencement and construction lien law brochure will be delivered to the person whose property is subject to attachment. Also, a certified copy of the recorded notice of commencement must be posted at the job site for the first inspection which occurs seven (7) days after the building permit i" sued. In absen e o uch posted notice, the inspection will not be approved and a reinspection fee will be charged. Signs The foregoing instrument was acknowledged before me this 14 r day of I [aIW 1, 20 121 by 1 eC"1 z-&b i. OYLSOL who is personally known to me or who has produced As ident c. ti . n and who did take an oath. NOTAR PUBLIC: Sign: /y�1 �y Print: 1 utr Cal Notary Public State of Florida M Avila My Commission DD964206 Expires 03/05/2014 My Commission Expires: * * * * * * * * * * * * * * * * * * * * * * * * * * * ** APPROVED BY Signature The foregoing in day of who is Contractor � ment was acknowledged before me this it-1) 20 _a by 2,,i�Zwn\'. Oyn4I'I n to me or who has produced as identification and who did take an oath. NOTARY PUBLIC: Sign: al • tear Po Notary Public State of Florida 34 �. M Avila Lc My Commission DD964206 % oc Expires 03/05/2014 Print: mII-W I My Commission Expires: 031()Slabl q * xr*+ x* ************ ****** **********+x+xrx**+a*********x ********* **a *** * * ** ********* Plans Examiner Structural Review (Revised 07 /10 /07)(Revised 06 /10/2009)(Revised 3/15/09) Zoning Clerk • .•., :••; i•r,;rrr•rr •9,!r p"m.. n:! y,; uvyunw.w uHu: myu :;,,yy:uyynu {quyuil,i.>f!fx.T1 UW ?i...... • CERTIFICATE OF INSURANCE I ISSUE DATE 01/31/2012 1 THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND, OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR_PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the poiicy(les) must be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder In lieu of such endorsementle). PRODUCER NORTHEAST AGENCIES, INC. _ 6467 MAIN STREET - SUITE 104 WILLIAMSVILLE, NY 14221 INSURER(S) AFFORDING COVERAGE INSURER A Underwriters at Lloyd's, of London INSURER INSURED EZ HOME IMPROVEMENT, INC P O BOX 971669 MIAMI, FL 33197 INSURER C INSURER D INSURER E ........... THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HERE N IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. INSR1 TYPE OF INSURANCE LTR POLICY NUMBER POLICY EFFECTIVE DATE POLICY EXPIRATION DATE LIMITS AMT002649 January 26, 2012 January 26, 2013 GENERAL AGGREGATE PRODUCTS- COMIOP AGO. PERSONAL & ADV. INJURY EACH OCCURRENCE DAMAGE TO PREMISES RENTED MED. EXPENSE (Any one person) $600,000 300,000 300,000 300.000 100,000 EXCLUDED PERSONAL LIABILITY COMBINED SINGLE LIMIT MEDICAL PAYMENTS TO OTHERS C EXCESS LIABILITY EACH OCCURRENCE AGGREGATE D E INLAND MARINE PROPERTY MISCELLANEOUS TOOLS BUILDING CONTENT LOSS OF USE THIS INSURANCE IS ISSUED PURSUANT TO THE FLORIDA SURPLUS LINES LAW. PERSONS INSURED BY SURPLUS LINES CARRIERS DO NOT HAVE THE PROTECTION OF THE FLORIDA GUARANTY ACT TO THE EXTENT OF ANY RIGHT OF RECOVERY FOR THE OBLIGATION OF AN INSOLVENT UNLICENSED INSURER. DESCRIPTION OF OPERATIONS f SPECIALTY ITEMS GENERAL CONTRACTOR SURPLUS LINES INSURERS' POLICY RATES AND FORMS ARE NOT APPROVED BY ANY FLORIDA REGULATORY AGENCY. City of Miami Shores Building Division 10050 NE 2 AVE Miami Shores, FL 33138 SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. AUTHORIZED REPRESENTATIVE VIRGINIA C. PHILLIPS SURPLUS LINES AGENT, UC# A206695 13577 FEATHERSOUND DR., PO BOX 17069 CLEARWATER, FL 33762 STATE OF FLORIDA DEPARTMENT OF BUSINESS AND PROFESSIONAL REGULATION CONSTRUCTION INDUSTRY LICENSING BOARD (850) 487 -1395 1940 NORTH MONROE STREET TALLAHASSEE FL 32399 -0783 ZIMBELMANN, ELM E Z HOME IMPROVEMENTS INC P 0 BOX 97 -1669 MIAMI FL 33197 -1669 Congratulaations! With this license you become one of the nearly one million Floridians licensed by the Department of Business and Professional Regulation. Our professionals and businesses range from architects to yacht brokers, from boxers to barbeque restaurants, and they keep Florida's economy strong. Every day we work to improve the way we do business in order to serve you better. For information about our services, please log onto www.myfiorldalicense.com. There you can find more information about our divisions and the regulations that impact you, subscribe to department newsletters and learn more about the Department's initiatives. Our mission at the Department is: License Efficiently, Regulate Fairly. We constantly strive to serve you better so that you can serve your customers. Thank you for doing business In Florida, and congratulations on your new license! DETACH HERE 03 -31 -2011 JEFF ATWATER STATE OF FLORIDA CHIEF FINANCIAL OFFICER DEPARTMENT OF FINANCIAL SERVICES DIVISION OF WORKERS' COMPENSATION * * CERTIFICATE OF ELECTION TO BE EXEMPT FROM FLORIDA WORKERS' COMPENSATION LAW CONSTRUCTION INDUSTRY EXEMPTION This certifies that the individual listed below has elected to be exempt from Florida Workers' Compensation law. EFFECTIVE DATE: PERSON: 03/31/2011 EXPIRATION DATE: 03/30/2013 ZIMBELMANN ELMER FEIN: 650836025 BUSINESS NAME AND ADDRESS: EZ HOME IMPROVEMENTS INC P 0 BOX 971889 MIAMI FL 33197 SCOPES OF BUSINESS OR TRADE: 1- RESIDENTIAL CONTRACTOR IMPORTANT: Pursuant to Chapter 440 . 05114), F.S., an officer of a corporation who elects exemption from this chapter by filing a certificate of election ander this section may not recover benefits or compensation under this chapter. Pursuant to Chapter 440.06412), F.S., Certificates of election to be exempt... apply only within the scope of the business or trade listed on the notice of election to be exempt. Pursuant to Chapter 440.05113), F.S., Notices of election to be exempt and certificates of election to be exempt shall be subject to revocation if, at any time after the filing of the notice or the issuance of the certificate, the person named on the notice or certificate no longer meets the requirements of this section for issuance of a certificate. The department shall revoke a certificate at any time for failure of the person named on the certificate lo meet the requirements of this section. QUESTIONS? (850) 413 -1609 DWC -252 CERTIFICATE OF ELECTION TO BE EXEMPT REVISED 01 -11 PLEASE CUT OUT THE CARD BELOW AND RETAIN FOR FUTURE REFERENCE STATE OF FLORIDA DEPARTMENT OF FINANCIAL SERVICES DIVISION OF WORKERS' COiMPEi1SATfON COPETRUCTION INDUSTRY CERTIFICATE OF ELECTION TO BE EXEMPT FROM FLORIDA WORKERS' COMPENSATION LAW EFFECTIVE 03 /31/2011 EXPIRATION DATE: 03/30/2013 PERSON: ELMER ZIMBELMM/N FEIN: 850838026 BUSINESS NAME AND ADDRESS: EZ HOME IMPROVEMENTS INC P 0 BOX 971669 MIAMI, FL 33197 SCOPE OF BUSINESS OR TRADE 1- RESIDENTIAL CONTRACTOR IMPORTANT OPursuant to Chapter 440.05(14), F.S., an officer of a corporation who elects exemption from this chapter by filing a certificate of election L under this section may not recover benefits or compensation under this D chapter. H Pursuant to Chapter 440.05(12), F.S., Certificates of election to be exempt.. apply only within the scope of the business or trade listed on Rthe notice of election to be exempt E Pursuant to Chapter 440.05113), F.S., Notices of election to be exempt and certificates of election to be exempt shall be subject to revocation if, at any time after the filing of the notice or the issuance of the certificate, the person named on the notice or certificate no longer meets the requirements of this section for issuance of a certificate. The department shall revoke a certificate at any time for failure of the person named on the certificate to meet the requirements of this Section. QUESTIONS? (850) 413 -1609 CUT HERE * Carry bottom portion on the job, keep upper portion for your records. DWC -252 CERTIFICATE OF ELECTION TO. BE EXEMPT REVISED 01 -11 404419 -4 BUSIN SS :AIVIE / L. , E DOME IP! 18505 S4! 104 A 33157 UNIN DADS LOOM. L 3U. IN SS 1A '' E E1PT * 2e1,` DAD COUNTY - STATF RID EXPIRES SEPT, 30, 2012 T INSPLAYEWAT 'PLA NEE TO COUNTY CODE CHAPTER SA THIS IS NOT A BILL - DO NOT PAY,. S I NC F'1RST, SS $ w TAOE PAO MAWS, FL. PERMIT NO. 231 OWNER E Z HOME IMPROVEMENTS Sec. T�yy of B ine 19 Su BU LDING CONTRA. THIS IS. ONLY A LOCAL BUSINESS. TAX RECEIPT. IT DOES NOT PERMIT THE HOLDER TO VIOLATE ANY EXISTING REGULATORY OR TONING LAWS OF -THE - COUNTY OR CITIES. NOR DOES IT EXEMPT THE HOLDER. FROM AN Y OTHER PERMIT - OR - LICENSE REQUIRED BY LAN. THIS IS NOT - A CERTIFICATION OF THE HOLDER'S QUALIFICA- TIONS. PAYMENT RECEIVED M AMI•DAOE COUNTY TAX COLLECTOR: 07/12/2011 60100000085 000075.00 SEE OTHER SIDE DO NOT FORWARD E Z HOME IMPROVEMENTS INC ELMER ZIMBELMANN JR P 0 BOX 971669 MIAMI FL 33197. 17l i111111111IIIIII11111 111111111ill1 111111ii1111111111I 3I 9� 6'('1 Permit No: 12-513 Job Name: March 26, 2012 Miami Shores Village Building Department 10050 N.E.2nd Avenue Miami Shores, Florida 33138 Tel: (305) 795.2204 Fax: (305) 756.8972 Page 1 of 1 Building Critique Sheet 1) Provide Wind load design criterion and the design wind loads for each opening by a licensed architect or engineer. FBC Existing Ch 6. Plan review is not complete, when all items above are corrected, we will do a complete plan review. If any sheets are voided, remove them from the plans and replace with new revised sheets and include one set of voided sheets in the re- submittal drawings. Norman Bruhn CBO 305 - 762 -4859 3- Cc3c;1 NOTICE OF COMMENCEMENT A RECORDED COPY MUST BE POSTED ON TIM JOB SITE AT TIME OF FIRST INSPECTION PERMIT NO. STATE OF FLORIDA COUNTY OF MIAMI -DADE: TAX FOLIO NO. — ,-13(0-001 - 01S0 THE UNDERSIGNED hereby gives notice that Improvements will be made to certain real property, and in accordance with Chapter 713, Florida Statutes, the following information Is provided in this Notice of Commencement 1. Legal descri ofpro.s street/address. 325 Nw 1 111111 11111111111111111111111111111111111111 CFN 2O12RO2595.94 OR Pk 28070 F's 1482; (1ps) RECORDED 04/12/2012 10 :26 :133 HARVEY RUVIN, CLERK OF COURT IIIANI -DARE COUNTYr FLORIDA LAST PAGE Space above reserved for use of recording office fi►e¢.� • i - i to a� I 2. Description of improvement {- j1Lv 1(flA le. Ie r.t.I4C.(S) tru..4 t 3. Owner(s) name and address: 1-a oh J . AU) OY) 5G Interest In property: 3 2" Ill W I I i Sh' eL "• %! 11:41/1/ 33) 108 Name and address of fee simple titleholder: 4. Contractor's name, address and phone number: 5. Surety: (Payment bond required by owner from contractor, if any) Name, address and phone number: Amount of bond $ 6. Lender's name and address: 7. Persons within the State of Florida designated by Owner upon .whom notices or Other documents may be served as provided by Section 713.13(1)(a)7., Florida Sta • • Name, address and phone number 8. In addition to himself, Owners designates the following person(s) to receive a copy of the Uenor's Notice as provided in Section 713.13(1)0), Florida Statutes. Name, address and phone number: 7-411-1Lei 5 St.tr) 104 L4 f' I s. M t am i H.- 3157 9. Expiration date of this Notice of Commencement (the expiration date is 1 year from the date of recording unless a different date is specified) WARNING TO OWNER: ANY PAYMENTS MADE BY THE OWNER AFTER THE EXPIRATION OF THE NOTICE OF COMMENCEMENT ARE CONSIDERED IMPROPER PAYMENTS UNDER CHAPTER 713, PART I, SECTION 713.13. FLORIDA STATI,1TES, AND CAN RESULT IN YOUR PAYING TWICE FOR IMPROVEMENTS TO YOUR PROPERTY. A NOTICE OF COMMENCEMENT MUST BE RECORDED AND POSTED ON THE JOB SITE BEFORE THE FIRST INSPECTION. IF YOU INTEND TO OBTAIN FINANCING, CONSULT WITH YOUR LENDER OR AN ATTORNEY BEFORE COMMENCING WORK OR RECORDING YOUR NOTICE OF • MENCEMENT. ,. Philip J. Zimbelmann 18506 SW 104 Avenue 015 FL 33157 h. 05 -890'1 Signature(s) of ' • Authorized Officer/ tor/Partner/Manager Piparei' o � Prepared By Print N - -= _ r[�y%� . ' OYI CI Print Name Title/Office Db)yie,rr" Title/Office •••• STATE OF FLORIDA COUNTY OF MIAMI-DADE 14 n.+'_ The forrgoing instrument ways acknowledged before me this I day of 1I U.I "' 1.�. . 1 1:1_,.y t_GL J . / l31iiSfz -- ziff Individually, or Cl as �/� for CI Personally known, or i!d'produced the following. type of identification: Signature of Notary Public: . Print. Name: (SEAL) VERIFICATION PURSUANT TO SECTION 92.525. FLORIDA STATUTES Under penalties of perjury I declare that I have read the foregoing and that the facts stated In it are true, to the best of my knowledge and belief. Big = er(s s)'s Authorized Officer/Director/Partner -82 PAGES Wm STATE OF FLORIDA, COUNTY OF DAOE I HEREBY CERTIFY that this is a true copy of they of orrginOlcd fl_I t s n-� """ _ 9., 48 x 32 to., 37 x 51 LI, 112x51 8. 37 x 27 7. 37 x 51 1. 112 x 51 FATAAB AWONSA 325 NW 111 STREET MIAMI SHORES. FL 33168 #2844 - ACCORDION � PANEL SHUTTERS 2. 19 x 51 3. 57 x 51 4. 57 x 51 TL/ 7 T LAI s 12, ___. 513 m.arni Shores Village ARPRO\i ED ZONING DEE F BLDG DEPT BY DA I E SUBJECT 1.0 COMPI JANICE WI (1-1 ALL FEDERAL STATE ANU COUN HELPS AND REGULATIONS RAMMS ENGINEERING, l C. Kd = .8 APR . , 2100 W 76 Street, .Hialeah, Florida 33016 FLORIDA BUILDIN - v DE, 2016 01Z Robert S. Monsour, P.E. Fl # 11955 / 0006024 ASCE 7 -10 WI 1a_I).E DESIGN WIND LOADS IN PSF. MIAMI DADE 175 MPH WIND ZONE Interior & Exterior Zones (4 45 - Walls). Positive Pressures Exposure C For the :175 mph Wind Zone CATEGORY 2 Height (Maximum) Effective Wind Area (or, Tributary Area) in Square Feet 10 20 .30. 40. 40 50 60 ' 1.00 0.95 0.92 ' 0.89. 0.88 0.86 15 40.4' 38.5 37.5 -39.1 36.7 36.1 .. 35.7 20 427 • '40.8 39.7 25 38.9 38.3 ' 37.8 25) 'L44.6� 42.6 41.5 . • 40.6 40.0 39.4 30 46.5 44.4 43.2 -51.4 42.3 41.7 41.1 40 49.4 47.2 . 45.9 -52.5 44:9 . ' .44.2 43.6 50 51.8 49.4 48.1 -53.4 47.1 46.4 45.7 60 53.7 51.2. 49.8 * 48.8 48.1 47.4 Interior Zone (4 Walls) Negative Pressures Exposure.0 For the 175 mph Wind Zone CATEGORY 2 Height (Maximum) Effective Wind Area (or, Tributary Area) in Square, Feet 10 20 30 40. 50 60 -1.10 -1.05 -1.02 -0.99 -0.98 -0.96 15 - 43.8 -42.0 • -40.9 -40.2 -39.6 -39.1 20 - 46.4 -44.4 -43.3 -42.5 - 41.9 -41.4" 25 (C-48.4-) -46.4 -45.2 -44.4 - 43.8 -43,2 3 -50.5 - 48.4 - 47.2 -46.3 -45.6 -45.1. 40 -53.6 -51.4 -50.1 . -49.1 " -48.4 -47:8 50 -56.2 -53.8 -52.5 -51.5 -50.7 -50.1 60 -58.2 -55.8 -54.4 -53.4 -52.6 -52.0 Exterior Zones (5 - Walls) Negative Pressures Exposure C For the 175 mph Wind Zone, CATEGORY 2 Height (Maximum) Effective Wind Area (or, Tributary Area) in Square Feet 10 20 30 - " .. 40 50 60 . =x:40 . • -1.29 -1.23 • -1.19 • , - 1.15 -1.13 . 1.5 . .. -54.1 -50..4 .. -48.3 -46.8 * -45.6 -44.7. • -57.2 - 53.4,, . ' -51 :1 -49.5 . -48.3 ' 47.3 ' X9.8 `T . -55:8 ` -53:4 .. : . -51.7 : - 50.4 -49.4 30 -62.3 -58.1 -55.7 . ` -53.9 -52.6 * . ' -51.5 40 -66.1 -61.7 -59.1 -57.2 • -55.8 -54.6 50 -69.3 -64.7 -61.9 -60.0 -58.5 -57.3 ti 60 -71.9 -67.0 -64.2 -62.2 -60.6 -59.4A Ali Length of End Zone (a): 10% of least horizontal dimension or .4 h, whichever is s but not less.than 4% of least horizontal dimension or 3 ft. (h = mean roof height in, '°et NOTE: AN 8% REDUCTION OF THE LOADS SHOWN ABOVE MAY BE TAKEN FOR FLAT RSOF� Date: ZCm 1 X12 County Code Compliance Municipalities Dear Officer, Please be advised that EZ Home Remodeling, as an active member in full compliance with Hi -Tech Shutter Group, Inc., has been authorized to use our Florida Building Code drawing with the FL # — 13110. If you have any inquiries regarding this matter, please feel free to contact my office at the numbers listed below. Respectfully, Magali Garmendia President Enclosed CC: Yovanna Diaz, Hi -Tech Coordinator 6865 NW 36 AVENUE, MIAMI, FL 33147 - PH: 305- 635 -0900 - FIB: 305- 634 -9078 HURRICA E SHUTTERS MANUFACTURES OF HURRICANE SHUTTERS' AND BUILDING PRODUCTS -NEW PRODUCT LINE FOR THE 21ST CENTURY 6865 N.W.36th AVENUE, MIAMI, FL 33147 • PHONE: (305) 635 -0900 / (800) 327 -0905 • FAX: (305) 634 -9078 www.Hursthurricaneshutters.com Shutter Product A. royal Authorization Form: Date: "31 ( tz_ Municipality: rr►(A i SnzAS Building Official: Hurst is the Dade County Notice of Acceptance Holder for the following: Product Description: "HT -100" ALUMINUM ACCORDION SHUTTER - UNIMATE Product Approval: 08- 1014.02 This letter authorizes: To use the above mentioned product at the following job: --L24 s� t : urst • wning Company, Inc. Magali Garmendia President 1: This form must accompany the application for building permit and shall become part of the permit documents 2: The authorized signature must bear the raised corporate seal of the company holding the Dade County ofAcceptance. 17 `�•,�•� v111111C Busines Profess' naI Ifu5tetic nlli,Rrh`etetally; BCIS Home Log In User Registration Hot Topics Product Approval USER: Public User Submit Surcharge Stilts & Facts E MMt Aoor°val Meng > Ptn ' or Aoollcetinn c rrFi • a Application List Search Criteria Code Version Application Type Category Application Status Quality Assurance Entity Product Model, Number or Approved for use in HVHZ Impact Resistant Other Page 1 of 1 Publications FBC Staff BCIS Site Map Links 2010 FL# ALL Product Manufacturer ALL HI -Tech Shutter Group ALL Subcategory ALL Compliance Method ALL ALL ALL Quality Assurance Entity Contract Expired ALL NameALL Product Description ALL Approved for use outside HVHZ ALL ALL ALL Design Pressure ALL Refine Search ALL Affirmation HI -Tech Shutter Group Category: Shutters Emma T. Mellinger, P.E. _ Subcatego : Accordion (954) 784 -6991 Approved by DBPR. Approvals b DBPR shall be reviewed and ratified b the POC and /or the Commission if necessary. Validated Search Contact is :: 1940 North Monroe t�, r n ss 02399 Phone: 85 0.g87_182g The State of Florida Is an AA/EEO employer. ram foht 200 10 7 -20 Stat of Fl Under Florida I�w, a -mall addresses are public records. If you do not want � � PrWaw State... =... Ac ac Ibllit� tatem t Refund Statemn -- Lt. send electronic mail to this entity. Instead, contact the office or your e-mail address released have v in response questions to a regarding BR's ADt, wdo eb not accessibility, by phone or by traditional mall If you have a ty, please contact our Web Master at webmaster©dbpr siar nY questions regarding DBPR's ADA web eflus. Product Approval Accepts: secttritv?.it t r;r.'• http : / /www.floridabuilding.org /pr /pr app_1st.aspx 3/19/2012 t Chapter 9B -72 F.A.C., Section 553.842 F.S. Pro duct Man ifarturer'" ti Hi -Tech Shutter Group 6865 NW 36th Avenue Miami, FL 33147 HTS.09002 9/25/2009 Report Number RepOrt Date lw Product Name /Model & Description: HT -loo Accordion Shutter Aluminum Accordion Shutter (HVHZ) Scope: This product has been evaluated by the below- signed Florida Professional Engineer for compliance with the Code noted herein and is, for the purpose intended, at least equivalent to that required by the Code, in accordance with section 553.842 F.S. & chapter 98 -72 F.A.C. Re- evaluation of this product shall be required following applicable Code modifications or revisions. Code: 2007 Florida Building Code, inclusive of all Supplements effective as of this report date. Compliance Method: 98- 72.070 (1)(d) — Evaluation Report from a licensed Professional Engineer Product Description: Product Approval Drawing #HTS.09002, prepared by Nu -Wind Engineering, signed and sealed by the below - signed Professional Engineer, Is an integral part of this Evaluation Report. Limitations Conditions of User This product has been evaluated for use within & outside the HVHZ (High Velocity Hurricane Zone) Impact Resistance: Large Missile Impact Resistant a Refer to Product Approval Drawing noted above for: o Maximum allowable wind loads at related maximum allowable size(s). o Other load limitations applicable to the product, if any. o Overall dimensions and material /grade of main product components, accessories, etc. o Illustrated diagrams of the attachment of the product to the structure. o Anchor type(s), size(s), substrate(s), embedment, edge distance, and spacing/locations. Test Re rts: l Test Lab Construction Testing Corp (CTC) — Hollywood, FL Construction Testing Corp (CTC) — Hollywood, FL Construction Testing Corp (CTC) — Hollywood, FL Construction Testing Corp (CTC) — Hollywood, FL Report Number 96 -024 97 -046 02 -039 08 -009 Engineering Analysis: performed: Test Standard & Description TAS 201 & 203 (impact & cyclic loading) TAS 202 (uniform static pressure) TAS 201 & 203 (impact & cyclic loading) _TAS 202 (uniform static pressure) TAS 201 & 203 (impact & cyclic loading) TAS 202 (uniform static pressure) TAS 201 & 203 (impact & cyclic loading) TAS 202 (uniform static pressure) The following engineering analyses and /or calculations have been • Comparative analysis has been performed based on the standard tests listed herein. o Rational analysis has been performed per Code requirements and acceptable standards of engineering principles (but not in lieu of standard tests required by the ° ° ° — Code), including the following: o Anchorage to resist applied design loads with required 4:1 safety factior o Structural load resistance of product components & /or assembly per Aluminum Design Manual 2005. m No increase in allowable stress has been used in the evaluation of this product. Page 1 of 1 Engineer's sign valid for pages re & seal 1 hrough 1 09 Christian Langley, •E Nu -Wind Engin- e }ing FL PE #67382 CA #28511 h ■"'" s" ATION OF OMPLIANu Rule 9N-3 F.A.C., Section 553.842 F.S. Product Manufacturer: F'r uct Desai Hi-Tech Shutter Group HT-100 Accordion Shutter 6865 NW 36th Avenue Aluminum Accordion Shutter NJ Miami, FL 33147 (HVHZ & Non-HVHZ) Building Code Compliance: The engineering evaluation for this product approval is in compliance 2 " " co with the 2010 Florida Building Code, inclusive of all adopted Supplements effective as of the above date. pa - All performance ratings and limitations of use noted in the existing documentation (i.e. evaluation reports, installation instructions, and related documents) remain applicable. Date: 3/14/2012 t's.) C) z -n Page 1 of 1 0 co to C 0 0 3 MAR'14-2012 ChristianLangiey', PE Nu-Wind Enene)ering FL PE #67382 'CA #28511 TE INDEPEN Chapter 9B -72 F.A.C., Section 553.842 F.S. .._ ._ Product Manufacturer• Hi -Tech Shutter Group 6865 NW 36th Avenue Miami, FL 33147 Date: 9/25/2009 Product Name /Model & Description: HT -1.00 Accordion Shutter Aluminum Accordion Shutter HVHZ & Non -HVHZ In accordance with Florida Statewide Product Approval requirements, the below- signed professional engineer certifies that he /she: Does not have, nor will acquire, a financial interest in any company manufacturing or distributing the above- referenced product for which evaluation or validation are being performed. a Does not have, nor will acquire, a financial interest in any other entity (e.g. test laboratory, quality assurance agency, validation entity) involved in the approval process of this product. Page 1 of 1 Engineer's signa valid for pa • es e & seal rough 1 Christian Langlz , 'E Nu -Wind Engin -e ng FL PE #67382 CA #28511 MIAMI. COUNT BUILDING CODE COMPLIANCE OFFICE (BCCO) PRODUCT CONTROL DIVISION NOTICE OF ACCEPTANCE (NOA) Hurst Awning Co., Inc. 6865 NW 36th Ave. Miami, FL 33147 MIAMI -DADE COUNTY, FLORIDA METRO -DADE FLAGLER BUILDING 140 WEST FLAGLER STREET, SUITE 1603 MIAMI, FLORIDA 33130-1563 (305) 375 -2901 FAX (305) 375 -2908 www.miamidade.gov SCOPE: This NOA is being issued under the applicable rules and regulations governing the use of construction materials. The documentation submitted has been reviewed by Miami -Dade County Product Control Division and accepted by the Board of Rules and Appeals (BORA) to be used in Miami Dade County and other areas where allowed by the Authority Having Jurisdiction (AHJ). This NOA shall not be valid after the expiration date stated below. The Miami -Dade County Product Control Division (In Miami Dade County) and/or the AHJ (in areas other than Miami Dade County) reserve the right to have this product or material tested for quality assurance purposes. If this product or material fails to perform in the accepted manner, the manufacturer will incur the expense of such testing and the AHJ may immediately revoke, modify, or suspend the use of such product or material within their jurisdiction. BORA reserves the right to revoke this acceptance, if it is determined by Miami -Dade County Product Control Division that this product or material fails to meet the requirements of the applicable building code. This product is approved as described herein, and has been designed to comply with the High Velocity Hurricane Zone of the Florida Building Code. DESCRIPTION: " HT -100 " Aluminum Accordion Shutter APPROVAL DOCUMENT: Drawing No. 08 -193, titled " HT -100 Accordion Shutter ", sheets 1 through 12 of 12, prepared by EngCo, Inc., dated July 09, 2008, signed and sealed by Pedro De Figueiredo, P.E., on October 06, 2008 bearing the Miami -Dade County Product Control Revision stamp with the Ndtice of Acceptance number and the expiration date by the Miami -Dade County Product Control Division. MISSILE IMPACT RATING: Large and Small Missile Impact LABELING: Each unit shall bear a permanent label with the manufacturer's name or logo, city, state and the following statement: "Miami -Dade County Product Control Approved ", unless otherwise noted herein. RENEWAL of this NOA shall be considered after a renewal application has been filed and there has been no change in the applicable building code negatively affecting the performance of this product. TERMINATION of this NOA will occur after the expiration date or if there has been a revision or change in the materials, use, and/or manufacture of the product or process. Misuse of this NOA as an endorsement of any product, for sales, advertising or any other purposes shall automatically terminate this NOA. Failure to comply with any section of this NOA shall be cause for termination and removal of NOA. ADVERTISEMENT: The NOA number preceded by the words Miami -Dade County, Florida, and followed by the expiration date may be displayed in advertising literature. If any portion of the NOA is displayed, then it shall be done in its entirety. INSPECTION: A copy of this entire NOA shall be provided to the user by the manufacturer or its distributors and shall be available for inspection at the job site at the request of the Building Official. This NOA revises NOA # 07- 0822.01 and consists of this page 1, evidence submitted pages E -1, E -2, E -3, E-4 & E -5 as well as approval document mentioned above. The submitted documentation was reviewed by Hte%hny A. Mak, ar, P.E., MS. S ii/06/2,c,o8 NOA No. 08- 1014.02 on Date: 01/13/2013 Page 1 Hurst Awning Co., Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 1. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #99- 0816.02 A. DRAWINGS 1. Drawing prepared by Knezevich & Associates, Inc., titled "HT100 Accordion Shutter," Drawing No. 99 -802, dated July 23, 1996, revision #6 dated June 10, 1999, sheets 1 through 6 of 6, signed and sealed by V..1 Knezevich, P.E. B. TESTS 1. See Association's generic approval under 99 -0036. C. CALCULATIONS 1. See Association's generic approval under 99 -0036. D. MATERIAL CERTIFICATIONS 1. See Association's generic approval under 99 -0036. E. STATEMENTS 1. Release letter issued by the Hi -Tech Shutter Group, Inc., dated August 3, 1999, cert fying this product to meet the criteria of product tested and approved, and allowing Hurst Awning Company Inc., to use the test results approved under Dade County Approval No. 99 -0036, signed by Mr. Frank Cornelius. 2. Acknowledgment letter by Hurst Awning Company, Inc., dated August 3, 1999, signed by Mr. Frank S. Cornelius. 3. Letter by Knezevich & Associates, Inc., dated August 10, 1999, certifying that the drawing (No. 99 -802) prepared for Hurst Awning Company, Inc., signed and sealed by Mr. V. J. Knezevich, P.E., is engineering wise identical to Hi- Tech's generic drawing (No. 96 -168). 4. Acceptance letter issued to Mr. Frank S. Cornelius on September 21, 1999 and returned signed by Mr. Frank S. Cornelius on September 21, 1999, indicating to please issue the proposed Notice of Acceptance as submitted and reviewed. 2. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #99- 1110.01 A. DRAWINGS 1. None. B. TESTS 1. `See Association's generic approval under 99 -0036. C. CALCULATIONS 1. See Association 's generic approval under 99 -0036. D. MATERIAL CERTIFICATIONS 1. See Association's generic approval under 99 -0036. E -1 elmy A. Maker, P.E., M.S. Product Control Examiner NOA No. 08- 1014.02 Expiration Date: 01/13/2013 Approval Date: 11/06/2008 Hurst Awning Co., Inc. • NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED E. STATEMENTS 1. Acceptance letter issued to Mr. Frank S. Cornelius on December 7, 1999 and returned signed by Mr. Frank S. Cornelius on January 11, 2000, to please issue the proposed Notice of Acceptance as submitted and reviewed 3. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #02- 0315.09 A. DRAWINGS See NOA 02-0315.09 (General Notes) B. TESTS • See NOA 99- 1110.01 C. CALCULATIONS See NOA 99- 1110.01 D. MATERIAL CERTIFICATIONS See NOA 99- 1110.01 E. STATEMENTS See NOA 99- 1110.01 F. OTHER See NOA 99- 1110.01 4. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL # 02- 1227.02 A. DRAWINGS 1. Drawing No. 02 -643, titled "HT100 Accordion Shutter" sheets 1 through 7 of 7, prepared by V.J. Knezevich, P.E., dated October 17, 2002, last revision #1 dated December 04, 2002, signed and sealed by V. J. Knezevich, P.E. B. TESTS 1. See Association's generic approval under 02 -0799. C. CALCULATIONS 1. See Association's generic approval under 02 -0799. D. MATERIAL CERTIFICATIONS 1. See Association's generic approval under 02 -0799. E -2 y A. Makar, P.E., M.S. Product Control Examiner NOA No. 08- 1014.02 Expiration Date: 01/13/2013 Approval Date: 11/06/2008 Hurst Awning Co., Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED 6. EVIDENCE SUBMITTED UNDER PREVIOUS APPROVAL #07- 0822.01 A. DRAWINGS 1. None. B. TESTS 1. See Association's generic approval under 05 -0321. C. CALCULATIONS 1. See Association's generic approval under 05 -0321. D. QUALITY ASSURANCE 1, By Miami Dade County Building Code Compliance Office. E. MATERIAL CERTIFICATIONS 1. See Association's generic approval under 05 -0321. F. STATEMENTS 1. Acceptance letter issued to Mr. Frank S. Cornelius on October 28, 2007 and returned signed by Mr. Frank S. Cornelius on October 29, 2007, indicating to please issue the proposed Notice of Acceptance as submitted and reviewed. 7. NEW EVIDENCE SUBMITTED A. DRAWINGS 1. Drawing No. 08 -193, titled " HT -100 Accordion Shutter ' , sheets 1 through 12 of 12, prepared by EngCo, Inc., dated July 09, 2008, signed and sealed by Pedro De Figueiredo, P.E., on October 06, 2008. B. TESTS 1, See Association's generic approval under 08 -1006. C. CALCULATIONS 1. See Association's generic approval under 08 -1006. D. QUALITY ASSURANCE 1. By Miami Dade County Building Code Compliance Office. ace. E. MATERIAL CERTIFICATIONS 1. See Association's generic approval under 08 -1006. E -4 y A. Maker, P.E., M.S. Product Control Examiner NOA No. 08- 1014.02 Expiration Date: 01/13/2013 Approval Date: 11/06/2008 Hurst Awning Co., Inc. NOTICE OF ACCEPTANCE: EVIDENCE SUBMITTED F. STATEMENTS 1. Release letter issued by the Hi -Tech Shutter Group, Inc., dated October 07, 2008, certifying this product to meet the criteria of product tested and approved,: arid. ' allowing Hurst Awning Co., Inc. to use the test results approved under Miami - Dade County Approval No. 08-1006, signed by Mr. Frank Cornelius. 2. Acknowledgment letter by Hurst Awning Co., Inc, dated October 07, 2008, signed by Frank Cornelius. 3. Letter by EngCa Inc., dated October 04, 2008, certifying that the drawing (No. 08 -193) prepared for Hurst Awning Co., Inc , signed and sealed by Mr. Pedro De Figueiredo, P.E., is engineering wise identical to Hi -Tech 's generic drawing. 4. Acceptance letter issued to Mr. Frank S. Cornelius on November 06, 2008 and returned signed by Mr. Frank S. Cornelius on November 06, 2008, indicating to please issue the proposed Notice of Acceptance as submitted and reviewed. E -5 A. Maker, P.E., M.S. Product Control Examiner NOA No. 08- 1014.02 Expiration Date: 01/13/2013 Approval Date: 11/06/2008 INDICES' SHEET 1 - INDICES, GENERAL NOTES, TYPICAL ELEVATION, ALLOWABLE BLADE PRESSURE TABLE 1 AND GLASS SEPARATION TABLE 2 SHEET 2 - SHUTTER COMPONENTS SHEET 3 - SHUTTER COMPONENTS, BLADE ASSEMBLY, ANCHOR SCHEDULE SHEET 4 - HORIZONTAL LOCK SECTIONS LOCK SHEET 5 - VERTICAL SECTIONS A, Al, D, D1 SHEET 6 - VERTICAL SECTIONS B, B1, B2, B3 SHEET 7 - VERTICAL SECTIONS C, Cl, E, El SHEET 8 - VERTICAL SECTIONS F, H, G SHEET 9 - VERTICAL SECTIONS L, L1 SHEET 10- VERTICAL SECTIONS I, R SHEET 11- HORIZONTAL SECTIONS J, Ji, K, K1 SHEET 12- SPAN TUBE OPTION 5ENERAL NOTES' 1- DEFINITION' THIS PRODUCT IS AN ACCORDION TYPE SHUTTER) DESIGNED, CONSTRUCTED AND ERECTED TO EASILY ENCLOSE AN OPENING, PROVIDING PROTECTION FROM HURRICANE FORCE WINDS AND WIND BORNE DEBRIS (LARGE & SMALL MISSILES) WITHIN THE ALLOWABLE DESIGNED PRESSURES AND LIMITATIONS STATED IN THIS APPROVAL. 2- CODE' THIS PRODUCT HAS BEEN TESTED AND DESIGNED IN ACCORDANCE WITH THE 2007 FLORIDA BUILDING CODE UNDER TAS 201, 202 AND 203. 3- POSTING' AT LEAST ONE PERMANENT LEGIBLE DECAL SHALL BE PLACED AT A READILY VISIBLE LOCATION STATING THE FOLLOWING' 'HURST AWNING COMPANY, INC. MIAMI - FLORIDA MIAMI -DADE COUNTY PRODUCT APPROVED' 4- LOADS' THE DESIGNED LOAD (BASED ON ASCE 7) MUST BE CALCULATED BY A PROFESSIONAL ARCHITECT OR ENGINEER FOR EACH SPECIFIC PROJECT. THE CALCULATED DESIGNED 'F ESSURE,MUST NOT EXCEED THE ALLOWABLE PRESSURES FOR EACH SHUTTER COMPONENTb TO BE USED. 5- MATERIAL' ALL EXTRUDED ALUMINUM SHAPES SHALL BE MADE OF 6063 -T6 OR AS NOTED. 6- FASTENERS' ASSEMBLY SCREWS AND ANCHORS SHALL BE AS SPECIFIED IN THE CURRENT SET OF DRAWINGS. INSTALLATION AND LOADS AS PER THIS APPROVAL. 7- USE' IT SHALL BE THE RESPONSIBILITY OF THE CONTRACTOR, ARCHITECT OR ENGINEER OF RECORD TO VERIFY THE FOLLOWING' 7,1- THE STABILITY OF THE STRUCTURE WHERE THE SHUTTER IS TO BE ATTACHED INSURING PROPER ANCHORAGE. • 7.2- THE SITE SPECIFIC PROJECT CRITERIA SUCH AS BUT NOT LIMITED TO WINDLOADS, LOCAL CODE REQUIREMENTS, DESIGNED PRESSURES ETC. 7,3- THAT THIS APPROVAL IS ADEQUATE TO THE SPECIFIC PROJECT. 8- WIND LOAD CALCULATION MUST BE IN COMPLIANCE WITH THE CURRENT ASCE 7 STANDARD, A DIRECTIONALITY FACTOR Kd =.85 SHALL BE USED. TABLE 1 MAXIMUM ALLOWABLE SHUTTER SPAN SCHEDULE TABLE 1 NOTES' 1- CASE 1- ACCORDION SHUTTER SPAN (INCHES) SCHEDULE FOR ALL CONDITIONS EXCEPT C, E AND F MOUNTS 2- CASE 2- ACCORDION SHUTTER SPAN (INCHES) SCHEDULE FOR MOUNTING CONDITIONS TYPE F OR TYPE C WITH SINGLE ANGLE (MAX. 3 -3/4' BUILT -OUT) 3- CASE 3- ACCORDION SHUTTER SPAN (INCHES) SCHEDULE FOR MOUNTING CONDITIONS TYPE C WITH DOUBLE 1/8' ANGLES OR SINGLE 1/4' ANGLE (MAX. 3 -3/4' BUILT -OUT). 4- CASE 4- ACCORDION SHUTTER SPAN (INCHES) SCHEDULE FOR MOUNTING CONDITIONS TYPE E.(MAX. 9 -3/16' BUILT -OUT) 5- PD- DESIGN WIND LOAD (PSF) 6- FOR DESIGN WIND LOADS BETWEEN TABULATED VALUES USE NEXT HIGHER LOAD OR LINEAR INTERPOLATION MAY BE USED TO DETERMINE ALLOWABLE SPANS. TYPICAL ELEVATION A, B, C, C1, D, E, El, F, I, L BLADE SIZE (BS) n A, Al, B, 81, 02, 83, C, C1, 0, 01, E, El, F,G,H,L,L1,R SHUTTER WIDTH (SW) NO LIMITATION TABLE 2 MINIMUM SHUTTER SEPARATION FROM GLASS SCHEDULE POSITIVE DESIGNED LOAD (PSF) CASES PD 1 2 3 4 30. 0 157 148 157 151 38. 0 .157 132 157 134 40. 0 155 128 149 131 48.0 148 117 124 120 52.0 145 112 115 115` 56.0 143 108 108 111 61.5 139 103 103 106 63. 3 138 102 102 104 66.8 131 99 99 101 67, 5 129 99 99 101 71,2 123 96 96 98 75.0 116 92 92 96 81,4 107 84 84 88 86.8 101 79 79 82 91.4 96 75 75 78 100.0 87 69 69 72 110.0 79 62 62 65 120.0 73 57 57 60 130.0 67 53 53 55 140.0 62 49 49 51 150.0 58 46 46 48 160.0 54 43 43 45 170.0 51 40 40 42 TABLE 1 NOTES' 1- CASE 1- ACCORDION SHUTTER SPAN (INCHES) SCHEDULE FOR ALL CONDITIONS EXCEPT C, E AND F MOUNTS 2- CASE 2- ACCORDION SHUTTER SPAN (INCHES) SCHEDULE FOR MOUNTING CONDITIONS TYPE F OR TYPE C WITH SINGLE ANGLE (MAX. 3 -3/4' BUILT -OUT) 3- CASE 3- ACCORDION SHUTTER SPAN (INCHES) SCHEDULE FOR MOUNTING CONDITIONS TYPE C WITH DOUBLE 1/8' ANGLES OR SINGLE 1/4' ANGLE (MAX. 3 -3/4' BUILT -OUT). 4- CASE 4- ACCORDION SHUTTER SPAN (INCHES) SCHEDULE FOR MOUNTING CONDITIONS TYPE E.(MAX. 9 -3/16' BUILT -OUT) 5- PD- DESIGN WIND LOAD (PSF) 6- FOR DESIGN WIND LOADS BETWEEN TABULATED VALUES USE NEXT HIGHER LOAD OR LINEAR INTERPOLATION MAY BE USED TO DETERMINE ALLOWABLE SPANS. TYPICAL ELEVATION A, B, C, C1, D, E, El, F, I, L BLADE SIZE (BS) n A, Al, B, 81, 02, 83, C, C1, 0, 01, E, El, F,G,H,L,L1,R SHUTTER WIDTH (SW) NO LIMITATION TABLE 2 MINIMUM SHUTTER SEPARATION FROM GLASS SCHEDULE POSITIVE DESIGNED LOAD (PSF) ACTUAL SPAN (INCHES) • INSTALLATION LESS THAN OR EQUAL TO 30' ABOVE GRADE INSTALLATION GREATER THAN 30' ABOVE GRADE 30 84 2 -7/8' 1 -5/8' 96 2 -7/8' 1 -5/8' 132 3' 2 -1/8' 157 3 -3/4' 2 -3/4' . 40' 84 2-7/8' t -5/8' 96 2 -7/8' 1 -5/8' 132 3' 2 -1/4' 155 3 -3/4' 3' 50 84 1-5/8' 1 -3/4' 96 41 01:10 132 2 -1/2' 146 3 -3/4' 3' 60 84 2 -7/8 1 -5/8' 96 2 -7/8' 1 -3/4' 132 3' 2 -3/4' 140 3 -3/4' 3' 70 84 1 -5/8' 96 - 1 -7/8' 115 2 -1/4' 124 3' 2 -5/8' 80 84 2 -7/8' 1 -3/4' 96 2 -7/8' 1 -7/8' 132 3-1/8' 3 -1/8' 90 84- 2 -T /8' Z -3/4' 96 2s --7/8' '2' 100 84 2 -7/8' 1 -3/4' 96 2 -7/8' 2' TABLE 2 NOTE' 1- ENTER ON TABLE 2 THE POSITIVE DESIGN WIND LOAD AND THE ACTUAL SPAN TO DETERMINE MINIMUM SHUTTER SEPARATION FROM GLASS. MANUFACTURER: Hurst Awning Company, Inc. 6865 NW 36th AVE. MIAMI, FLORIDA 33147 TEL.: (305) 635-0900 FAX.: (305) 634 -9078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: EngTrr .lttr. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO@AOL.COM OCT ' . 62000 Engineer Seat Pedro De Flgueiredo, PE 52609 DRAFTING' PINUMMIa NNE MIAMI -DADE BCCO' PROUVt T REVISED as ansplying with the livitahla .13 Date: 07/09/08 Scale: NA Design by: PPMF Drawing Number 08 -193 Sheet 1 of 12 4- ADJ. SILL TOP Cu Cu in 7- FLAT END SLAT SHUTTER COMPONENTS I-1. 497- -I 5- ADJ. SILL -BOT 5A- ALTERNATIVE ADJ. SILL-BUT 11A- ANGLES 6063 -T6 2. 0 -I 0 .600 -4 3- SILL -WALL MOUNTED 097 1-1, 391-1 I 1. 891 9- CENTER MATE 1 3, 000 55 .L, --1. 724[- 6- .RECESS TRACK `,N T o 10- CENTER MATE 2 24- OPTIONAL HANDLE . 50 8- TYPICAL SLATS 3. 993 Cu u7 A 8A- ADAPTER SLAT 16- WALKOVER SILL TRACK _Lo h 948-I 9B- UNIMATE MANUFACTURER: Hurst Awning Company, Inc. 6865 NW 36th AVE. MIAMI, FLORIDA 33147 TEL.: (305) 635 -0900 • FAX: (305) 634 -9078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: En>gQht lint. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO@AOL.COM Engineer Seal Pedro De Flgueiredo, PE 52809 DRAFTING! PK TINS a 1111111E MIAMI -DADE DCCEIs PRODUCT REVISED as emptying with the Florida B alding Cods Acceptansc No Date: 07/09/08 Scale: NA Design by: PPMF Drawing Number 08 -193 Sheet 2 of 12 TYPICAL BLADE ASSEMBLY 23 : 12A -WHEEL CARRIER • / EVERY OTHER BLADE 120 . 375 SHUTTER COMPONENTS 188 634 23 2 1 h ...����LLL CY3 0 ri 13- LOCK INSERT 0 U7 r, • U7 . 688 MANUFACTURER: Hurst Awning Company, Inc. 6865 NW 36th AVE. MIAMI. FLORIDA 33147 TEL: (305) 635-0900 FAX.: (305) 634-9078 PRODUCT: HT -100 ACCORDION SHUTTER 1. 749 14- LOCKING ARM 1/8' THICK STAINLESS STEEL 0 cu co M C1---i�VARIES -(12` MIN. > 18- HANDLE SHIM (NYLON) 1. 22 o co 0 ring: gT CA 16 697 W. Sunrise Blvd. 104 P1: ; r ' . n, FI. 33313 EN CO@AOL.COM 1, 35 373 1. 0001 -- 0 15- STACK LOCKING CLIP 6063 -T6 14A- LOCKIN PIN (OPTIONAL) 6063 -T6 W/ #6 THUMB SCREW USED WITH PIECES 9A & 10A 360 - . 150 . 630 0 17- LOCKING ARM ALIGMENT BUSHING (NYLON) 12A— CARRIER H . 2309' MAX 12C-BUTT' 12- BUSHINGS NYLON TYP. AT EVERY OTHER '. JOINT AT TOP 12D- ROLL . 000 60' 1. 0 3. 000 1, 600 --f—1 010.4 23A- 2' LONG 23B- 3' LONG 23- #14 SCREW WITH #10 HEAD 410 HT STAINLESS STEEL (W/ FLUOROCARBON COATED) 22— WASHER STAINLESS STEEL ANCHOR SCHEDULE TYPE DESCRIPTION EMB E. D. A , -' 1 • . ' 000 PS '' ' 1. 75 3. 0 r,[gA■gm'ila foa iainw -..cm40 01W0 1.75 1.10 2.5 2.0 Al 4' I - - r` i i - . r 1/4' ELCO ULTRACON INTO CONCRETE BLOCK 1.25 2,0 B 1/4-20X1 ALL POINTS INTO 3, 0 KSI CONCRETE 0. 875 3. 0 El 1/4 -20X1 ALL POINTS INTO CONCRETE BLOCK 0.875 3.0 £ 5/16' ELCO ULTRACON INTO 3. 5 KSI CONCRETE 1. 75 3. 0 Cl •5/16' ELCO ULTRACON INTO CONCRETE BLOCK 1.25 3.0 E 1/4' WOOD LAG SCREW INTO G =. 55 WOOD 1. 50 0. 75 NOTES' ED EDGE DISTANCE SHALL BE BEYOND WALL DRESSING EMB'EMBEDMENT SHALL BE BEYOND WALL DRESSING 1/4' TAPCON CAN BE USED IN REPLACE OF 1/4' LAG SCREWS Engineer Seal Pedro De Figueiredo, PE 52609 DRAFTING' PK & INIE MIAMI —DADE BCCO' PRODUCT REVIEW as essaPlylaBwitb the Nelda Balding Code Acceptance No015 0 •02 Bon Date I •1? Date: 07/09/08 Scale: NA Design by: PPMF Drawing Number 08 -193 Sheet 3 of 12 SECTION LOCK OPTIONS FOR LOCK BLADE ASSEMBLY 6 1/2' TYPICAL IPTItiNAL USED FOR STACKING- TYPICAL ALTERNATE INSIDE LOCK HANDLE 1 II I TIONAL SCREW USED FUR STACKING TYPICAL PUSH - BUTTOM LOCK INSIDE OR OUTSIDE OPTIONAL. 14 ALTERNATE INSIDE LOCK HANDLE ttI I 2 14A OPTIONAL e OPTIONAL USED FUR STACKING TYPICAL 1 TIUNAL SCREW USED FUR STACKING 7 TYPICAL r 1OA CK HANDLE 1 /4X1 1/2 PULL PIN INSIDE OR OUTSIDE kLa r g I- T 1/4 -20X1 THUMB SCREW INSIDE OR OUTSIDE p I- 'EACH SHUTTER UNIT TO USE A MINIMUM ONE LOCK. LOCKING MECHANISM CAN BE LOCATED 18' ABOVE OR BELOW BLADE MID POINT AND AT ANY HORIZONTAL LOCATION. LOCKING MECHANISM SHALL BE PLACED IN THE LOCKED POSITION TO PROVIDE HURRICANE PROTECTION MANUFACTURER Hurst Awning Company, Inc, 6865 NW 36th AVE. MIAVIS,'FLORIDA 33147 TEL.: (3051635-0900 FAX.: (305) 634 -9078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: 7EngCin lint. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO @AOL.COM Engineer Seal Pedro Do Flgueiredo, PE 52609 DRAFTING' PK BIOTIN i& MORE MIAMI -DADE BCCUz PRODUCT REVISED as complying With droner& 8altilg Cede Acceptance N, • f b • b Es „a Etta Date: 07/09/08 Scale: NA Design by: PPMF Drawing Number 08 -193 Sheet 4 of 12 SECTION A WALL MOUNT SECTION (HEADER OR SILL) ANCHORS SPACED AS PER TABLE BELOW MB. SECTION Al SILL MOUNT SECTION (SILL) ANCHORS SPACED AS PER TABLE BELOW MAX. BLADE SPAN IN INCHES DESIGNED EMB- ---i .05 -2X 1 AND -05-2X-2 6063 -T6 ALUMINUM TUBE ANCHORS SPACED AS PER TABLE BELOW SECTION D TUBE WALL MOUNT SECTION (HEADER OR SILL) +nm;lir.= ^ In rck SEE TABLE 2 FOR GLASS SEPARATION *..*,:r -I- SECTION D1 TUBE WALL MOUNT SECTION (SILL) ANCHORS SPACED AS PER TABLE BELOW 1/8 -2X1 AND 1/8 -2X2 6063 -T6 ALUMINUM TUBE n.t.nua IIrr. PRESSURES IN PSF-1 MAXIMUM ANCI -ICR SPACING IN INCHES ON CENTER 157 108 96 68 I A Al B B1 C Cl E A Al B B1 C Cl E A Al B B1 C Cl E A Al B B1 C Cl E SECTIONS: A- SILL / HEADER Al- SILL 45 5 - 6 4 7 - 5 7 - 9 10 - 8 8 - 10 7 12 5 9 12 - 12 10 12 7 12 , 57 4 4 3 5 _ 4 6 7 _6 5 _ 8 6 7 8 5 9 7 10 - 11 8 12 6 10 73 - - 3 - - - 3 4 - '5 4 6 - 5 5 - 6 4 7 - 5 7 - 8 6 10 - 8 105 - - - - - - - 3 - 3 - - - 3 - - 4 3 5 - 4 5 - 6 4 7 - 5 - - SECTIONS: D- SILL! HEADER D1- SILL MEM �a MEM RI 170 - - IMI 9 — f�iL7 — III 8 12 tmaiE.1I - e 9 12 6 ailnaL U $PPEim 9 IF FA = - oo© FiItc70 - minooum - IMMIll - m ©IMINErao®EnIMo 8 FIII - 7 III - E11111171iMOIIMi [111111M10111 - i, - MI MI - FBI MION - 11:1•[ill - - WM= - - Ec7C111 - IMIIFIIIIIM - MI© - F111E•C1111e11M1t7 - MANUFACTURER Hurst Awning Company, Inc. 6865 NW 36th AVE., MIAMI, FLORIDA 33147 TEL.: (305) 635 -0900 FAX.: (305) 634 -9078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: EngQin lint. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO@AOL.COM Engineer Seel Pedro De Figueiredo, PE 52609 DRAFTING' lK NAME aMI MIAMI -DADE BCCO' PRODUCE REVISED as eamplying with the Raids Buisling Cade A te •, o 2 Oste' .0 01Y By DWision Date: 07/09/08 Scale: NA Design by PPMF Drawing Number 08 -193 Sheet 5 of 12 SECTION B INSET MOUNT (HEAD OR SILL) °� (ED) EDGE :T DISTANCE ANCHORS SPACED AS PER TABLE BELOW ¢� -1 SEE TABLE 2 - FOR GLASS - SEPARATION /5 3/16 " 5052 ALUM: ALLOY POP RIVETS OR 512 TEK SCREWS AT 6' OC FRONT AND BACK ANCHORS SPACED AS PER TABLE BELOW EQ. (ED) EDGE ~DISTANCE SECTION 53 FRONT ANCHOR ADJUSTABLE FLOOR MOUNT (SILL ONLY) SEE TABLE 2 FOR GLASS - SEPARATION ANCHORS SPACED AS PER TABLE BELOW SECTION 51 ADJUSTABLE FLOOR MOUNT (SILL ONLY) MAX. BLADE SPAN IN INCHE SEE ANCHOR SCHEDULE ON SHEET 3 FOR ANCHOR TYPE DESIGNED PRESSURES IN PSF SECTION B SILL/HEADER 3/16" 315211.19 AIR PBP RI'EIS B IVY lilt SCES IT 6' IL FEINT MID 1101 TIDNAL LOCATION ANCHORS SPACED AS PER TABLE BELOW SECTION B2 • REAR ANCHOR ADJUSTABLE FLOOR MOUNT (SILL ONLY) SEE TABLE 2 - FUR GLASS - SEPARATION < Zr X.i /5 Cr) 3116" SA211ln X AIiDY PDP RIIEIS 61112111 I� IBM 6' F11811 NIB 1/8 -1X1 6063 -T6 ALUMINUM ANGLE (ED) EDGE DISTANCE ANCHORS SPACED AS PER TABLE BELOW MAXIMUM ANCHOR SPACING IN INCHES ON CENTER 157 108 96 C I:TSl1lT![aMAIM EMU* MOWN MI1411 MAI MIN UM WWI NANILM lNMI 111111 WAN Um..loll KIN [M r311111111.1g1IIIMIRMEIIIMIIMIEINEFA 10 IIFFAIi1Fii [7•Mii1 ®m ®[7i1MITIi[1fEFAIMAIMMEflI ., rw w11E11111[7oClMl.'IEI IIM -I•CillIillfI70 - RS7IIMIN 7EF11E1111iF. 4 allMIM7 FF. PEICIIIVIIIWIIINIMIIIFIEWAIIISMIIIIMMITIMIIIIRMIIIIMINIME11111FAIRIIMIFIVICIIIIIIT UT IFFJUI a isAMINC7IMIFEIEIIll4IMSIMIIMI NIIQIEIMI EIMIIMIL>tOtMEIIIsElammai FAMIII M 170 SECTIONS 81 OR 83 SILL 45 6 8 4 9 57 S 6 3 7 6 12 5 5 9 9 10 7 12 5 7 I2 4 .12 11 5 7 6 10 5 10 73 4 5 4 7 4 5 4 8 105 5 4 3 5 4 12 9 12 8 10 8 8 12 6 6 12 3 5 - 6 4 5 6 8 4 170 4 5 SECTION 52 SILL 45 4 - 4 3 6 - 3 6 - 7 5 8 - 5 6 - 8 5 10 - 5 9 - 11 8 12 6 8 57 - - 3 - - - - 4 - _5 4 7 - 4 5 - 6 4 7 - 4 7 - 8 6 11 - 6 73 - - 3 - - - - - - 4 3 5 - 3 4 - 4 3 6 - 3 5 - 7 5 8 - 5 105 - - - - - - - - - 3 3 - - - 4 3 6 - 3 MANUFACTURER Hurst Awning Company, Inc. 6865 NW 36th AVE. MIAMI, FLORIDA 33147 TEL: (305) 635 -0900 FAX.:;(305) 6349078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: fugal". .2tr. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO@AOL.COM Pedro De Figueiredo, PE 52609 DRAFTING a IONE MIAMI -DADE BCCO' PRODUCE REVISED as einagylag wai thaltdde Balding Code Acam N® Date Division Date: 07/09/08 Scale: NA Design by: PPMF Drawing Number 08 -193 Sheet 6 of 12 SECTION C ANGLE BUILT -OUT MOUNT (HEAD OR SILL) CL •'•! SEE TABLE 2 FOR LASS SEPARATION #14- 14x3/4' SS SMS AT 12'0C SECTION H SILL ANGLE ADJUSTABLE SILL MOUNT V7 ANCHORS SPACED AS PER TABLE BELOW 11 Ci (ED) EDGE 1"---DISTANCE MAX. BLADE SPAN IN INCHES SEE ANCHOR SCHEDULE ON SHEET 3 FOR ANCHOR TYPE DESIGNED PRESSURES IN PSF W PA SECTION F BUILT -OUT TRACK WALL MOUNT SECTION (HEADER OR SILL) WHEEL ASSEMBLY APPLICABLE ONLY FOR HEADE Ni- ANCHORS SPACED AS PER TABLE BELOW rZ I~<: SEE TABLE 2 FIR GLASS SEPARATION ANCHORS SPACED AS PER TABLE BELOW SECTION G WALKOVER TRACK MOUNT (SILL ONLY) (ED) EDGE ''DISTANCE MAXIMUM ANCHOR SPACING IN INCHES ON CENTE SECTION G SILL SECTION F HEADER / SILL 45 57 73 105 170 12 4 2 9 7 5 12 9 157 108 96 Wif�q[t�il�i�f� 45 8 - 9 7 11 5 8 12 - 12 10 12 7 12 12 4 12 11 r 12 8 12 12 57 6 7 5 9 7 9 11 8 12 5 10 10 12 9 12 6 11 12 73 6 4 7 - 7 8 105 4 3 '5 - 5 6 6 10 - 4 7 - 8 8 5 6 9 7 11 6 4 8 9 6 12 8 - 12 12 12 8 5 12 11 4 6 12 12 12 11 12 4 12 12 12 12 9 12 10 7 12 12 9 7 11 5 9 170 2 3 3 4 3 5 4 5 4 7 5 SECTION H 5" SILL 45 - ' - 3 - - - - 4 ' - 5 T3 6 - - 4 5 - 5 4 ' 7 - 4 7 - 8 6 10 - 6 57 - - - - - - - - - 4 3 5 - 3 4 - 4 3 5 - 3 5 - 6 4 8 - 5 73 .. - - -. - - - - - - - - 4 - 4 3 6 - 3 4 - 5 - 5 3 6 - 4 105 7 5 9 - 5 105 - - - - - - - - - 3 - - - - - - 3 - - - - 170 - - - - - - - - - - - - - - - - - - - - - - - - - - - SECTION H 3" SILL 45 4 - 5 3 6 - 3 -6 - 7 5 9 - 5. 7 - 8 6 11 - 6 10 - 12 8 12 6 9 57 - - 4 3 5 - 3 5 - 6 4 7 - 4 5 - 6 5 8 - 5 8 ,- 9 7 12 5 7 73 - - 3 - - - - 4 - 4 3 6 - 3 4 - 5 3 6 - 3 6 - 7 5 9 - 5 105 - - - - - - - - - 3 - - - - - - 3 - - - - 4 - 5 3 6. - 3 170 - - - - - MANUFACTURER: Hurst Awning Company, Inc. 6865 NW 36th AVE. MIAMI, FLORIDA 33147 TEL.: (305) 635 -0900 FAX.: (305) 6349078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: 3En #CIe Jnr. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO@AOL.COM Engineer Seal Pedro De Figuelredo, PE 52609 DRAFTING 1111AFTINa IMRE MIAMI -DADE BCCD' PRODUCE REVISED as eamplyhag with the Melds Bekliag Cede meeptmteeNW 0 o Date. Division Date: 07/09/08 Scale: NA Design by: PPMF Drawing Number 08 -193 Sheet 8 of 12 SECTION 'L WALL MOUNT SECTION OVER. STUD WALL (HEAD OR SILL) <3 PER WOOD TRUSS) 1/4' WOOD LAG SCREWS OR 1/4' TAPCONS W/ 2' PENETRATION INTO WOOD TRUSS SPACED NO LONGER THAN 24'OC 1/8 -1X3 OR 1/8 -1X4 6063 —T6 ALUMINUM TUBE 1/8 -1X3 OR 1/8 -1X4 6063 —T6 ALUMINUM TUBE 14 -20X1 GRADE 5 HHSDS @ 3'0C BETWEEN EACH TRUSS III MI Mii/IIllilUllI11111ii:- N� La H H —4 ¢ F�- Lai Fl4 q J 634 x H 6...4 Lai La V1 SEE TABLE 2 FUR_ ~GLASS SEPARATI(II 2X6 PT WOOD SG > =. 5 (3 ®PER WOOD TRUSS) 1/4' WOOD LAG SCREWS OR 1/4' TAPCONS W/ 2' PENETRATION INTO WOOD TRUSS SPACED NO LONGER THAN 24.00 SECTION BETWEEN WALL STUDS 14 -20X1 GRADE 5 HHSDS @ 3'OC BETWEEN EACH TRUSS SECTION BETWEEN WALL STUDS SECTION L1 WALL MOUNT SECTION OVER STUD WALL (SILL) SEE TABLE 2 fill? GLASS SEPARATIIPI• SECTION AT WALL STUD LOCATION DESIGN ON THIS SHEET LIMITED BY: MAX. DESIGN PRESSURE = ± 72 PSF MAX. BLADE = 102" EE SECTION A ANCHOR TYPE E FOR ANCHOR SPACING IN BETWEEN STUDS 0 in n OPTIONAL INSTALLATION WITH 2X6 PT WOOD <SG > =.55) SECTION AT WALL STUD LOCATION ¢� A :ICI Ell l∎ttil'1UV 1/8- 1X3 6063 —T6 ALUMINUM TUBE a OPTIONAL INSTALLATION WITH 2X6 PT WOOD <SG > =. 55) SECTION AT WALL STUD LOCATION 43 PER WOOD TRUSS) 1/4' WOOD LAG SCREWS OR 1/4' TAPCONS W/ 2' PENETRATION INTO WOOD TRUSS SPACED NO LONGER THAN 24'0C <3 PER WOOD TRUSS) 1/4' WOOD LAG SCREWS OR 1/4' TAPCONS W/ 2' PENETRATION INTO WOOD TRUSS SPACED NO LONGER THAN 24'OC i.Y9IU04;= SEE SECTION Al ANCHOR TYPE E FOR ANCHOR SPACING IN BETWEEN STUDS „111`r.111`il'd11b 2X6 PT WOOD SG> _. 5 MANUFACTURER: Hurst Awning Company, Inc. 6865 NW 36th AVE. MIAMI, FLORIDA 33147 TEL.: (30,5).635-0900 FAX.: {305) 634.9078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: +.Engtan inr. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO @AOL.COM OCT i 62001 Engineer Seel Pedro De Flguetredo, PE 52609 DRAFTING' Ptilliffrag aE MIAMI —DADE BCCOs PRODUCT REVISED asessiplyingsebthelelerlds A NOB' 0 *0 E 1 BY Date: 07/09/08 Scale: NA Design by. PPMF Drawing Number 08 -193 Sheet 9 of 12 SECTION R (R ALTERNATE) RECESSED FLOOR MOUNT (SILL ONLY) SEE TABLE 2 FOR GLASS -- SEPARATION 2' EDGE__�_._1 3/4' DISTANCE SECTION R RECESSED FLOOR MOUNT (SILL ONLY) '7 3/16' TAPCON @ 24.0C WITH 1 1/4' MIN, EMBEDMENT INTO MASONRY, CONCRETE OR WOOD CUT 3/4X1 1/4' GROOVE INTO EXISTING CONCRETE FLOOR STRUCTURE TO FIT PART *6 SEE TABLE 2 FOR GLASS -- SEPARATION 2 1/2' EDGE DISTANCE CUT 3/4X1 1/4' GROOVE INTO EXISTING CONCRETE FLOOR STRUCTURE TO FIT PART #6 1/4' TAPCON @ 12'0C WITH 1 1/4' MIN. EMBEDMENT INTO MASONRY, CONCRETE OR WOOD (4 PER WOOD TRUSS) 1/4'X3' WOOD LAG SCREWS W/ MIN. 2' PENETRATION INTO WOOD TRUSS SPACED NO LONGER THAN 24'0C SEE TALE 2 — FIR GLASS — SEPARATION OPTIONAL SECTION I TRUSS MOUNT (HEAD ONLY) TABLE 4 BLADE SPAN PRESSURE 102' *65 96' . *68 92', ' *72 SEE TABLE ri.500 ONTINUOUS 1/8x6 6063 -T6 ALUMINUM PLATE 1. 50 SECTION I TRUSS MOUNT (HEAD ONLY) (3 PER WOOD TRUSS) 1/4'X3' WOOD LAG SCREWS W/ MIN, 2' PENETRATION INTO WOOD TRUSS SPACED NO LONGER THAN 24'0C SEE TABLE 2 — FOR GLASS — SEPARATION 1 ONTINUOUS 1/8x4 6063 -T6 ALUMINUM PLATE (5 SCREWS IN BETWEEN TRUSSES) 14 -20X1 GRADE 5 HHSDS @ 4'0C INTO 1/8' 6063 -T6 PLATE ONTINUOUS 1 /8x 6063 -T6 ALUMINUM PLATE MANUFACTURER: Hurst Awning Company, Inc. 8865 NW 36th AVE. MIAMI, FLORIDA 33147 TEL: (3Q5) 635 -0900 FAX.: (305) 634 -9078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: f itgQic ,i nr. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO@AOL OM OCT 0 2008 Engineer Seal Pedro De Figuel edo, PE 52609 ETINDRAGr llt & Imo MIAMI -DADE BCCOh PRODUCT REVISED as complying with the Florida Bolding Code Acceptance N Exp ; :. *Dater IF /h7 _J-.. I miDadc, '" Division Date: 07/09/08 Scale: NA Design by: PPMF Drawing Number 08 -193 Sheet 10 of 12 MB. SECTION J JAMB CLOSURE INSET MOUNT ASTENER AT 18'0C USE ANY ANCHOR IN ANCHOR SCHEDULE �7 1/4 -20 THMS W/ NUT & LOCK WASHERS SPACED AT 24'0C 1/8 -2X2 ALUM. ANGLE #10X3/4' SS SMS OR 3/16' POP RIVETS SPACED AT 18'0C SECTION KI CORNER CLOSURE SECTION J1 JAMB CLOSURE WALL MOUNT ASTENER AT 24'0C USE ANY ANCHOR IN ANCHOR SCHEDULE • (ED) EDGE DISTANCE #10X3/4' SS SMS OR 3/16' POP RIVETS SPACED AT 18'0C ASTENER AT 24'0C USE ANY ANCHOR IN ANCHOR SCHEDULE (ED) EDGE DISTANCE th a' .0 ix as 1' /7 IN. 0. 055' THICK ALUMINUM CLOSURE ANGLES VARIES SIZES ANGLE 6063 —T6 3/16' 152 ALUM. POP R I VETS S FORA 2X2X1/8 6063 —T6 ALUMINUM TUBE 1X2X1 /8'X2' 6063 —T6 ALUM ANGLE CLI• (2 PER CLIP) 1/4' FASTENERS ANCHOR SCHEDULE EPTABLE ANCHO SECTION K CORNER CLOSURE #10X3/4' SS SMS OR 3/16' POP RIVETS SPACED AT 24'OC NOTE' EITHER CONDITION TYPI SIDE MANUFACTURER: Hurst Awning Company, Inc. 6865 NW 36th AVE. MIAMI, FLORIDA 33147 TEL.: (305) 635 -0900 FAX.: (305) 634-9078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: Eztgtitr CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCO@AOL.COM Engineer Seal Pedro De Rgueiredo, PE 52609 DRAFTING' Infilla a INK MIAMI —DADE BCCOI PRODU I71ZEV1SD es ewn►piyta with thentwilIts Bedding Code Acceptance No O Eupi : dun Date Date: 07/09!08 Scale: NA Design by PPMF Drawing Number 08 -193 Sheet 11of12 . 000 9. 000 . 00 0 1, 500— 5. 000 �L125 2X5 TUBE It, N I-I T • 000 L224 2X8 TUBE N 1 2X9 TUBE MB SPAN TUBES SECURING INSET MOUNT SECTION OPTION MAX. PRESSURE 72 PSF TYPICAL TOP & BOTTOM 1/4' ALL POINTS SOLID SET ANCHORS SEE TABLE 3 FOR SELECTION OF NGLE CONNECTION CON 1 OR CON 2 MIN. 1.0 TOP BEAM SEE TABLE 3 FOR SELECTION 1/4' -20 PHMSS OLTS & NUTS AT 12'OC LI LJ ISTING CONCRETE OR HOLLOW BLOCK A y LJ 1/4' -20 PHMSS BOLTS & NUTS AT 12'OC 1 , 5--I EMB, BOTTOM BEAM j SEE TABLE 3 FOR SELECTION \-ACCESS HOLE TYPICAL TOP & BOTTOM (3) 1/4' PHMSS BOLTS & NUTS SEE TABLE 3 FOR SELECTION OF ANGLE CONNECTION CON 1 OR CON 2 C.1 ANGLE CONNECTION 1 (CON1) II 1. 500-1 I 3. 00 ANGLE CONNECTION 2 (CON2) I-1., 3.000 0 . o 1_1.500 . 00 0 ANGLE NOTE' 2X3X1/4 6063 -T6 ALUMINUM ALLOY ANGLE TOP & BOTTOM CON 1- USE 6' LONG ANGLES WHEN TWO ANCHORS ARE REQUIRED CON 2- USE 9' LONG ANGLES WHEN THREE ANCHORS ARE REQUIRED TABLE 3 TOP BEAM BOTTOM BEAM BEAM SIZE (IN) SHUTTER SPAN (IN) BEAM LENGTH (IN) CON TYPE BEAM LENGTH (IN) CON TYPE 2X5 60 98 CON 1 113 CON 1 96 87 CON 1 97 . CON 1 120 82 CON 1 90 CON.1 2X8 60 100 CON 1 168 CON 1 96 89 CON 1 138 CON:2 120 • 84 CON 1 124 CON 2 2X9 60 100 CON 1 185 CON 1 96 91 CON 1 148 CON 2 120 86 CON 2 133 CON 2 TABLE 3 NOTES1 1- TOP AND BOTTOM BEAMS MAY BE USED TOGETHER OR IN COMBINATION WITH OTHER MOUNTING CONDITIONS. THE LESSER DESIGN PRESSURE AND SPAN WILL GOVERN. 2- WHERE IF USED TOGETHER BEAM LENGTH MUST BE LIMITED BY THE TOP BEAM LENGTH DESIGN ON THIS SHEET LIMITED BY: MAX. DESIGN PRESSURE = ± 72 PSF MAX. BLADE = 120" Cu MANUFACTURER: Hurst Awning Company, Inc. 6865 NW 36th AVE. MIAMI, FLORIDA 33147 TEL.: (305) 635 -0900 FAX.: (305) 634 -9078 PRODUCT: HT -100 ACCORDION SHUTTER Engineering: Engtto .Jnr. CA 8116 6971 W. Sunrise Blvd. 104 Plantation, Fl. 33313 ENGCOQAOL.COM Engineer Seal Pedro De Figuelredo, PE 52609 DRAFTING+ NNW=a ME MIAMI -DADE BCCO' FRODUCI as complying withibliddi Sa Cede Acceptance to D Ex, . ,.Non Date By Dade Division -o it Date: 07/09/08 Scale: NA Design by: PPMF Drawing Number 08 -193 Sheet 12 of 12